SLC25A41 polyclonal antibody
  • SLC25A41 polyclonal antibody

SLC25A41 polyclonal antibody

Ref: AB-PAB28136
SLC25A41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC25A41.
Información adicional
Size 100 uL
Gene Name SLC25A41
Gene Alias FLJ40442|MGC34725
Gene Description solute carrier family 25, member 41
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQDTVEGSNPTMRGVLQRILAQQGWLGLYRG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant SLC25A41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284427
Iso type IgG

Enviar un mensaje


SLC25A41 polyclonal antibody

SLC25A41 polyclonal antibody