PPP1R12C polyclonal antibody
  • PPP1R12C polyclonal antibody

PPP1R12C polyclonal antibody

Ref: AB-PAB28130
PPP1R12C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R12C.
Información adicional
Size 100 uL
Gene Name PPP1R12C
Gene Alias DKFZp434D0412|LENG3|p84
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 12C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PPP1R12C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54776
Iso type IgG

Enviar un mensaje


PPP1R12C polyclonal antibody

PPP1R12C polyclonal antibody