QRFP polyclonal antibody
  • QRFP polyclonal antibody

QRFP polyclonal antibody

Ref: AB-PAB28115
QRFP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant QRFP.
Información adicional
Size 100 uL
Gene Name QRFP
Gene Alias 26RFa|MGC119794|P518
Gene Description pyroglutamylated RFamide peptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant QRFP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 347148
Iso type IgG

Enviar un mensaje


QRFP polyclonal antibody

QRFP polyclonal antibody