KIF7 polyclonal antibody
  • KIF7 polyclonal antibody

KIF7 polyclonal antibody

Ref: AB-PAB28106
KIF7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF7.
Información adicional
Size 100 uL
Gene Name KIF7
Gene Alias MGC120653|MGC138476|MGC138478|UNQ340
Gene Description kinesin family member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MWINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant KIF7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374654
Iso type IgG

Enviar un mensaje


KIF7 polyclonal antibody

KIF7 polyclonal antibody