HS2ST1 polyclonal antibody
  • HS2ST1 polyclonal antibody

HS2ST1 polyclonal antibody

Ref: AB-PAB28104
HS2ST1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HS2ST1.
Información adicional
Size 100 uL
Gene Name HS2ST1
Gene Alias FLJ11317|KIAA0448|MGC131986|dJ604K5.2
Gene Description heparan sulfate 2-O-sulfotransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant HS2ST1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9653
Iso type IgG

Enviar un mensaje


HS2ST1 polyclonal antibody

HS2ST1 polyclonal antibody