THUMPD2 polyclonal antibody
  • THUMPD2 polyclonal antibody

THUMPD2 polyclonal antibody

Ref: AB-PAB28103
THUMPD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THUMPD2.
Información adicional
Size 100 uL
Gene Name THUMPD2
Gene Alias C2orf8|MGC2454
Gene Description THUMP domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant THUMPD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80745
Iso type IgG

Enviar un mensaje


THUMPD2 polyclonal antibody

THUMPD2 polyclonal antibody