GZF1 polyclonal antibody
  • GZF1 polyclonal antibody

GZF1 polyclonal antibody

Ref: AB-PAB28029
GZF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GZF1.
Información adicional
Size 100 uL
Gene Name GZF1
Gene Alias ZBTB23|ZNF336
Gene Description GDNF-inducible zinc finger protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MLEVAEKLKCLDLSETCFQLKKQMLESVLLELQNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GZF1
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 64412
Iso type IgG

Enviar un mensaje


GZF1 polyclonal antibody

GZF1 polyclonal antibody