TSGA14 polyclonal antibody
  • TSGA14 polyclonal antibody

TSGA14 polyclonal antibody

Ref: AB-PAB28028
TSGA14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSGA14.
Información adicional
Size 100 uL
Gene Name TSGA14
Gene Alias Cep41|DKFZp762H1311
Gene Description testis specific, 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLITGSLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSGA14
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 95681
Iso type IgG

Enviar un mensaje


TSGA14 polyclonal antibody

TSGA14 polyclonal antibody