ZNF618 polyclonal antibody
  • ZNF618 polyclonal antibody

ZNF618 polyclonal antibody

Ref: AB-PAB28026
ZNF618 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF618.
Información adicional
Size 100 uL
Gene Name ZNF618
Gene Alias FP13169
Gene Description zinc finger protein 618
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VIELSNESQPTLQLVLPTYVRLEKLFTAKANDAGTVSKLCHLFLEALKENFKVHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESWAEEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10 - 1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF618
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 114991
Iso type IgG

Enviar un mensaje


ZNF618 polyclonal antibody

ZNF618 polyclonal antibody