RCOR2 polyclonal antibody
  • RCOR2 polyclonal antibody

RCOR2 polyclonal antibody

Ref: AB-PAB28023
RCOR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RCOR2.
Información adicional
Size 100 uL
Gene Name RCOR2
Gene Alias -
Gene Description REST corepressor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RCOR2
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283248
Iso type IgG

Enviar un mensaje


RCOR2 polyclonal antibody

RCOR2 polyclonal antibody