MRPS24 polyclonal antibody
  • MRPS24 polyclonal antibody

MRPS24 polyclonal antibody

Ref: AB-PAB28022
MRPS24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPS24.
Información adicional
Size 100 uL
Gene Name MRPS24
Gene Alias HSPC335|MRP-S24
Gene Description mitochondrial ribosomal protein S24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPS24
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 64951
Iso type IgG

Enviar un mensaje


MRPS24 polyclonal antibody

MRPS24 polyclonal antibody