BCL7A polyclonal antibody
  • BCL7A polyclonal antibody

BCL7A polyclonal antibody

Ref: AB-PAB28020
BCL7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCL7A.
Información adicional
Size 100 uL
Gene Name BCL7A
Gene Alias BCL7
Gene Description B-cell CLL/lymphoma 7A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCL7A
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 605
Iso type IgG

Enviar un mensaje


BCL7A polyclonal antibody

BCL7A polyclonal antibody