SYF2 polyclonal antibody
  • SYF2 polyclonal antibody

SYF2 polyclonal antibody

Ref: AB-PAB28017
SYF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYF2.
Información adicional
Size 100 uL
Gene Name SYF2
Gene Alias CBPIN|DKFZp564O2082|NTC31|P29|fSAP29
Gene Description SYF2 homolog, RNA splicing factor (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYF2
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 25949
Iso type IgG

Enviar un mensaje


SYF2 polyclonal antibody

SYF2 polyclonal antibody