UGT2A1 polyclonal antibody
  • UGT2A1 polyclonal antibody

UGT2A1 polyclonal antibody

Ref: AB-PAB28013
UGT2A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UGT2A1.
Información adicional
Size 100 uL
Gene Name UGT2A1
Gene Alias -
Gene Description UDP glucuronosyltransferase 2 family, polypeptide A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UGT2A1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 10941
Iso type IgG

Enviar un mensaje


UGT2A1 polyclonal antibody

UGT2A1 polyclonal antibody