ZNF512B polyclonal antibody
  • ZNF512B polyclonal antibody

ZNF512B polyclonal antibody

Ref: AB-PAB28007
ZNF512B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF512B.
Información adicional
Size 100 uL
Gene Name ZNF512B
Gene Alias GM632|KIAA1196|MGC149845|MGC149846
Gene Description zinc finger protein 512B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200 - 1:500)
Immunofluorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF512B
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 57473
Iso type IgG

Enviar un mensaje


ZNF512B polyclonal antibody

ZNF512B polyclonal antibody