MAGEA10 polyclonal antibody
  • MAGEA10 polyclonal antibody

MAGEA10 polyclonal antibody

Ref: AB-PAB28005
MAGEA10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAGEA10.
Información adicional
Size 100 uL
Gene Name MAGEA10
Gene Alias MAGE10|MGC10599
Gene Description melanoma antigen family A, 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAGEA10
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4109
Iso type IgG

Enviar un mensaje


MAGEA10 polyclonal antibody

MAGEA10 polyclonal antibody