INPP4A polyclonal antibody
  • INPP4A polyclonal antibody

INPP4A polyclonal antibody

Ref: AB-PAB28004
INPP4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INPP4A.
Información adicional
Size 100 uL
Gene Name INPP4A
Gene Alias INPP4
Gene Description inositol polyphosphate-4-phosphatase, type I, 107kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INPP4A
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 3631
Iso type IgG

Enviar un mensaje


INPP4A polyclonal antibody

INPP4A polyclonal antibody