C3orf25 polyclonal antibody
  • C3orf25 polyclonal antibody

C3orf25 polyclonal antibody

Ref: AB-PAB27997
C3orf25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C3orf25.
Información adicional
Size 100 uL
Gene Name C3orf25
Gene Alias -
Gene Description chromosome 3 open reading frame 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunoflurorescence (1-4 µg/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C3orf25
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90288
Iso type IgG

Enviar un mensaje


C3orf25 polyclonal antibody

C3orf25 polyclonal antibody