SMG6 polyclonal antibody
  • SMG6 polyclonal antibody

SMG6 polyclonal antibody

Ref: AB-PAB27944
SMG6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMG6.
Información adicional
Size 100 uL
Gene Name SMG6
Gene Alias C17orf31|EST1A|KIAA0732|SMG-6
Gene Description Smg-6 homolog, nonsense mediated mRNA decay factor (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLRNKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMG6.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 23293
Iso type IgG

Enviar un mensaje


SMG6 polyclonal antibody

SMG6 polyclonal antibody