DENND1C polyclonal antibody
  • DENND1C polyclonal antibody

DENND1C polyclonal antibody

Ref: AB-PAB27942
DENND1C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DENND1C.
Información adicional
Size 100 uL
Gene Name DENND1C
Gene Alias FAM31C|FLJ22757
Gene Description DENN/MADD domain containing 1C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DENND1C.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 79958
Iso type IgG

Enviar un mensaje


DENND1C polyclonal antibody

DENND1C polyclonal antibody