SHQ1 polyclonal antibody
  • SHQ1 polyclonal antibody

SHQ1 polyclonal antibody

Ref: AB-PAB27941
SHQ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SHQ1.
Información adicional
Size 100 uL
Gene Name SHQ1
Gene Alias DKFZp686H07226|FLJ10539
Gene Description SHQ1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ELKDSPSETVSSLQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIEELGEQLKTTVQVSEPKGTTAVNRSNIQERDGCQTPNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SHQ1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 55164
Iso type IgG

Enviar un mensaje


SHQ1 polyclonal antibody

SHQ1 polyclonal antibody