OSBPL2 polyclonal antibody
  • OSBPL2 polyclonal antibody

OSBPL2 polyclonal antibody

Ref: AB-PAB27934
OSBPL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OSBPL2.
Información adicional
Size 100 uL
Gene Name OSBPL2
Gene Alias FLJ20223|KIAA0772|MGC4307|MGC8342|ORP-2|ORP2
Gene Description oxysterol binding protein-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OSBPL2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 9885
Iso type IgG

Enviar un mensaje


OSBPL2 polyclonal antibody

OSBPL2 polyclonal antibody