DEFB108B polyclonal antibody
  • DEFB108B polyclonal antibody

DEFB108B polyclonal antibody

Ref: AB-PAB27930
DEFB108B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEFB108B.
Información adicional
Size 100 uL
Gene Name DEFB108B
Gene Alias -
Gene Description defensin, beta 108B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEFB108B.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 245911
Iso type IgG

Enviar un mensaje


DEFB108B polyclonal antibody

DEFB108B polyclonal antibody