DUS2L polyclonal antibody
  • DUS2L polyclonal antibody

DUS2L polyclonal antibody

Ref: AB-PAB27928
DUS2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DUS2L.
Información adicional
Size 100 uL
Gene Name DUS2L
Gene Alias DUS2|FLJ20399|SMM1|URLC8
Gene Description dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCEREQNRVVFQMGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DUS2L.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 54920
Iso type IgG

Enviar un mensaje


DUS2L polyclonal antibody

DUS2L polyclonal antibody