TRIM43 polyclonal antibody
  • TRIM43 polyclonal antibody

TRIM43 polyclonal antibody

Ref: AB-PAB27925
TRIM43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIM43.
Información adicional
Size 100 uL
Gene Name TRIM43
Gene Alias -
Gene Description tripartite motif-containing 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIM43.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 129868
Iso type IgG

Enviar un mensaje


TRIM43 polyclonal antibody

TRIM43 polyclonal antibody