DHX34 polyclonal antibody
  • DHX34 polyclonal antibody

DHX34 polyclonal antibody

Ref: AB-PAB27923
DHX34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DHX34.
Información adicional
Size 100 uL
Gene Name DHX34
Gene Alias DDX34|HRH1|KIAA0134
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 34
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TYDPRYRINLSVLGPATRGSQGLGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DHX34.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 9704
Iso type IgG

Enviar un mensaje


DHX34 polyclonal antibody

DHX34 polyclonal antibody