HEATR5B polyclonal antibody
  • HEATR5B polyclonal antibody

HEATR5B polyclonal antibody

Ref: AB-PAB27919
HEATR5B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HEATR5B.
Información adicional
Size 100 uL
Gene Name HEATR5B
Gene Alias KIAA1414
Gene Description HEAT repeat containing 5B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VPPPVSAALQGIKSIVTLSMAKTEAGVQKQWTALIRSTLACILEYSQPEDSVPTPDEVSMLTAIALFLWSASNEIIGVQSLQNGCMNRF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HEATR5B.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 54497
Iso type IgG

Enviar un mensaje


HEATR5B polyclonal antibody

HEATR5B polyclonal antibody