SPNS1 polyclonal antibody
  • SPNS1 polyclonal antibody

SPNS1 polyclonal antibody

Ref: AB-PAB27918
SPNS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPNS1.
Información adicional
Size 100 uL
Gene Name SPNS1
Gene Alias FLJ38358|HSpin1|LAT|PP2030|SPIN1|SPINL|nrs
Gene Description spinster homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPNS1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 83985
Iso type IgG

Enviar un mensaje


SPNS1 polyclonal antibody

SPNS1 polyclonal antibody