FAM125A polyclonal antibody
  • FAM125A polyclonal antibody

FAM125A polyclonal antibody

Ref: AB-PAB27916
FAM125A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM125A.
Información adicional
Size 100 uL
Gene Name FAM125A
Gene Alias CFBP|FLJ32495
Gene Description family with sequence similarity 125, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM125A.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 93343
Iso type IgG

Enviar un mensaje


FAM125A polyclonal antibody

FAM125A polyclonal antibody