C19orf52 polyclonal antibody
  • C19orf52 polyclonal antibody

C19orf52 polyclonal antibody

Ref: AB-PAB27914
C19orf52 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf52.
Información adicional
Size 100 uL
Gene Name C19orf52
Gene Alias -
Gene Description chromosome 19 open reading frame 52
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf52.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 90580
Iso type IgG

Enviar un mensaje


C19orf52 polyclonal antibody

C19orf52 polyclonal antibody