LSM7 polyclonal antibody
  • LSM7 polyclonal antibody

LSM7 polyclonal antibody

Ref: AB-PAB27913
LSM7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LSM7.
Información adicional
Size 100 uL
Gene Name LSM7
Gene Alias YNL147W
Gene Description LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RSGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LSM7.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 51690
Iso type IgG

Enviar un mensaje


LSM7 polyclonal antibody

LSM7 polyclonal antibody