C19orf47 polyclonal antibody
  • C19orf47 polyclonal antibody

C19orf47 polyclonal antibody

Ref: AB-PAB27912
C19orf47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf47.
Información adicional
Size 100 uL
Gene Name C19orf47
Gene Alias DKFZp686P05129|FLJ36888
Gene Description chromosome 19 open reading frame 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf47.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 126526
Iso type IgG

Enviar un mensaje


C19orf47 polyclonal antibody

C19orf47 polyclonal antibody