CLN5 polyclonal antibody
  • CLN5 polyclonal antibody

CLN5 polyclonal antibody

Ref: AB-PAB27910
CLN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLN5.
Información adicional
Size 100 uL
Gene Name CLN5
Gene Alias FLJ90628|NCL
Gene Description ceroid-lipofuscinosis, neuronal 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLN5.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 1203
Iso type IgG

Enviar un mensaje


CLN5 polyclonal antibody

CLN5 polyclonal antibody