HNRNPUL2 polyclonal antibody
  • HNRNPUL2 polyclonal antibody

HNRNPUL2 polyclonal antibody

Ref: AB-PAB27904
HNRNPUL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HNRNPUL2.
Información adicional
Size 100 uL
Gene Name HNRNPUL2
Gene Alias DKFZp762N1910|HNRPUL2
Gene Description heterogeneous nuclear ribonucleoprotein U-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HNRNPUL2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 221092
Iso type IgG

Enviar un mensaje


HNRNPUL2 polyclonal antibody

HNRNPUL2 polyclonal antibody