C19orf40 polyclonal antibody
  • C19orf40 polyclonal antibody

C19orf40 polyclonal antibody

Ref: AB-PAB27898
C19orf40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf40.
Información adicional
Size 100 uL
Gene Name C19orf40
Gene Alias FAAP24|FLJ46828|MGC32020
Gene Description chromosome 19 open reading frame 40
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf40.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 91442
Iso type IgG

Enviar un mensaje


C19orf40 polyclonal antibody

C19orf40 polyclonal antibody