C16orf88 polyclonal antibody
  • C16orf88 polyclonal antibody

C16orf88 polyclonal antibody

Ref: AB-PAB27893
C16orf88 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf88.
Información adicional
Size 100 uL
Gene Name C16orf88
Gene Alias 101F10.1|FAM178A
Gene Description chromosome 16 open reading frame 88
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQQNLQRDYDRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf88.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 400506
Iso type IgG

Enviar un mensaje


C16orf88 polyclonal antibody

C16orf88 polyclonal antibody