FAM217B polyclonal antibody
  • FAM217B polyclonal antibody

FAM217B polyclonal antibody

Ref: AB-PAB27892
FAM217B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM217B.
Información adicional
Size 100 uL
Gene Name FAM217B
Gene Alias C20orf177|dJ551D2.5
Gene Description family with sequence similarity 217, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHPRKKGKAESCGHATVSSEKKLKTNGVKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM217B.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 63939
Iso type IgG

Enviar un mensaje


FAM217B polyclonal antibody

FAM217B polyclonal antibody