OSBPL1A polyclonal antibody
  • OSBPL1A polyclonal antibody

OSBPL1A polyclonal antibody

Ref: AB-PAB27889
OSBPL1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OSBPL1A.
Información adicional
Size 100 uL
Gene Name OSBPL1A
Gene Alias FLJ10217|ORP-1|ORP1|OSBPL1B
Gene Description oxysterol binding protein-like 1A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OSBPL1A.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 114876
Iso type IgG

Enviar un mensaje


OSBPL1A polyclonal antibody

OSBPL1A polyclonal antibody