ANKRD2 polyclonal antibody
  • ANKRD2 polyclonal antibody

ANKRD2 polyclonal antibody

Ref: AB-PAB27887
ANKRD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD2.
Información adicional
Size 100 uL
Gene Name ANKRD2
Gene Alias ARPP|MGC104314
Gene Description ankyrin repeat domain 2 (stretch responsive muscle)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq IIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 26287
Iso type IgG

Enviar un mensaje


ANKRD2 polyclonal antibody

ANKRD2 polyclonal antibody