CCDC81 polyclonal antibody
  • CCDC81 polyclonal antibody

CCDC81 polyclonal antibody

Ref: AB-PAB27881
CCDC81 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC81.
Información adicional
Size 100 uL
Gene Name CCDC81
Gene Alias FLJ16339|FLJ23514
Gene Description coiled-coil domain containing 81
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NHKNEKPEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC81.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60494
Iso type IgG

Enviar un mensaje


CCDC81 polyclonal antibody

CCDC81 polyclonal antibody