BCL2L14 polyclonal antibody
  • BCL2L14 polyclonal antibody

BCL2L14 polyclonal antibody

Ref: AB-PAB27877
BCL2L14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCL2L14.
Información adicional
Size 100 uL
Gene Name BCL2L14
Gene Alias BCLG
Gene Description BCL2-like 14 (apoptosis facilitator)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCL2L14.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 79370
Iso type IgG

Enviar un mensaje


BCL2L14 polyclonal antibody

BCL2L14 polyclonal antibody