HMOX2 polyclonal antibody
  • HMOX2 polyclonal antibody

HMOX2 polyclonal antibody

Ref: AB-PAB27876
HMOX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HMOX2.
Información adicional
Size 100 uL
Gene Name HMOX2
Gene Alias HO-2
Gene Description heme oxygenase (decycling) 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HMOX2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 3163
Iso type IgG

Enviar un mensaje


HMOX2 polyclonal antibody

HMOX2 polyclonal antibody