BRAP polyclonal antibody
  • BRAP polyclonal antibody

BRAP polyclonal antibody

Ref: AB-PAB27873
BRAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BRAP.
Información adicional
Size 100 uL
Gene Name BRAP
Gene Alias BRAP2|IMP|RNF52
Gene Description BRCA1 associated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BRAP.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 8315
Iso type IgG

Enviar un mensaje


BRAP polyclonal antibody

BRAP polyclonal antibody