STARD13 polyclonal antibody
  • STARD13 polyclonal antibody

STARD13 polyclonal antibody

Ref: AB-PAB27863
STARD13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STARD13.
Información adicional
Size 100 uL
Gene Name STARD13
Gene Alias DLC2|FLJ37385|GT650
Gene Description StAR-related lipid transfer (START) domain containing 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NPVMLDAPLVSSSLPQPPRDVLNHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLQQEPESFKAMQCIQIPNGDLQNSPPPACRKGLPC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STARD13.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 90627
Iso type IgG

Enviar un mensaje


STARD13 polyclonal antibody

STARD13 polyclonal antibody