KDELC2 polyclonal antibody
  • KDELC2 polyclonal antibody

KDELC2 polyclonal antibody

Ref: AB-PAB27861
KDELC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KDELC2.
Información adicional
Size 100 uL
Gene Name KDELC2
Gene Alias MGC33424
Gene Description KDEL (Lys-Asp-Glu-Leu) containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LPVRYFYLQAVNSEGQNLTRSPAGETPFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLYGDEHVAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KDELC2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 143888
Iso type IgG

Enviar un mensaje


KDELC2 polyclonal antibody

KDELC2 polyclonal antibody