PGAM5 polyclonal antibody
  • PGAM5 polyclonal antibody

PGAM5 polyclonal antibody

Ref: AB-PAB27852
PGAM5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PGAM5.
Información adicional
Size 100 uL
Gene Name PGAM5
Gene Alias BXLBv68|MGC5352
Gene Description phosphoglycerate mutase family member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PGAM5.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 192111
Iso type IgG

Enviar un mensaje


PGAM5 polyclonal antibody

PGAM5 polyclonal antibody