NR1H3 polyclonal antibody
  • NR1H3 polyclonal antibody

NR1H3 polyclonal antibody

Ref: AB-PAB27851
NR1H3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NR1H3.
Información adicional
Size 100 uL
Gene Name NR1H3
Gene Alias LXR-a|LXRA|RLD-1
Gene Description nuclear receptor subfamily 1, group H, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NR1H3.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 10062
Iso type IgG

Enviar un mensaje


NR1H3 polyclonal antibody

NR1H3 polyclonal antibody