IFT80 polyclonal antibody
  • IFT80 polyclonal antibody

IFT80 polyclonal antibody

Ref: AB-PAB27850
IFT80 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFT80.
Información adicional
Size 100 uL
Gene Name IFT80
Gene Alias ATD2|KIAA1374|MGC126543|WDR56
Gene Description intraflagellar transport 80 homolog (Chlamydomonas)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKSLGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFT80.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57560
Iso type IgG

Enviar un mensaje


IFT80 polyclonal antibody

IFT80 polyclonal antibody