LRRC15 polyclonal antibody
  • LRRC15 polyclonal antibody

LRRC15 polyclonal antibody

Ref: AB-PAB27848
LRRC15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC15.
Información adicional
Size 100 uL
Gene Name LRRC15
Gene Alias LIB
Gene Description leucine rich repeat containing 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 131578
Iso type IgG

Enviar un mensaje


LRRC15 polyclonal antibody

LRRC15 polyclonal antibody