ARHGAP18 polyclonal antibody
  • ARHGAP18 polyclonal antibody

ARHGAP18 polyclonal antibody

Ref: AB-PAB27845
ARHGAP18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP18.
Información adicional
Size 100 uL
Gene Name ARHGAP18
Gene Alias FLJ25728|MGC126757|MGC138145|MacGAP|bA307O14.2
Gene Description Rho GTPase activating protein 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq STTIKVMEKPPFDRSISQDSLDELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLSNLFGESAGDPQESI
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP18.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 93663
Iso type IgG

Enviar un mensaje


ARHGAP18 polyclonal antibody

ARHGAP18 polyclonal antibody